funny words

if u guys have any funny words or words that have funny definitions, post them.
mine is hippopotomonstrosesquippedaliophobia:the fear of long words. im not kidding!!!!!!! ITS 36 LETTERS LONG!!!!!!!!!!!!!!!!!!!

AIRSOFT what kind of a word is that

kidding, the real word is bradenation, the use of whining pouting and such to get what you want.

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit



some name of a country in Asia!

mgunner i don't bieleve it

heres one, 36 letters long Pneumonoultramicroscopicsilicovolcanoconiosis

and one on wikipedia is like 200,000 letters long and it just shows the first like 10 and last 10 letters

I know that one! Its a disease you get from breathing volcanic ash or another partical like that!

greek and 183 letters in shakespeares plays

Lopadotemakhoselakhogameokranioleipsanodrimypotrimmatosilphiokarabomelitokatakekhymenokikhlepikossyphophattoperisteralektryonoptokephalliokigklopeleiolagōiosiraiobaphētraganopterýgōn

85 letters Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahul

this word with 45 letters is just funny too Chargoggagoggmanchauggagoggchaubunagungamaugg,

Im getting some sort of disease from reading all of these.

I have googled some of these and I think that they are fake.

Indeed except for the greek one check out the accents.

Quote :

`` Deleted ´´

jew isn't funny

how about pokemon???????LOL LOL ROTFL

posie...just what kind of word is posie..I mean who would name a flower a posie..its like the worlds most unmanliest word ever.

Flibberdegibbet


Someone who talks too much

tabernacle - a place where one goes to pray? (i think)
perplex - to confuse

Ya but i am Jewish

ManBearPIg is and animal that is half man half bear and half pig

its not a word but the math term/ # pi, it goes on foreveeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrrrrrrrr.

bilotzi

duece xD

methionylglutaminylarginyltyrosylglutamylserylleucyl phenylalanylalanylglutaminylleucyllysylglutamylarginyl lysylglutamylglycylalanylphenylalanylvalylprolylphenyl alanylvalylthreonylleucylglycylaspartylprolylglycylisol eucylglutamylglutaminylserylleucyllysylisoleucylaspartyl threonylleucylisoleucylglutamylalanylglycylalanylaspartyl alanylleucylglutamylleucylglycylisoleucylprolylphenyl alanylserylaspartylprolylleucylalanylaspartylglycylprolyl threonylisoleucylglutaminylasparaginylalanylthreonylleucyl arginylalanylphenylalanylalanylalanylglycylvalylthreonyl prolylalanylglutaminylcysteinylphenylalanylglutamyl methionylleucylalanylleucylisoleucylarginylglutaminyllysyl histidylprolylthreonylisoleucylprolylisoleucylglycylleucyl leucylmethionyltyrosylalanylasparaginylleucylvalylphenyl alanylasparaginyllysylglycylisoleucylaspartylglutamylphenyl alanyltyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylserylvalylleucylvalylalanylaspartylvalyl prolylvalylglutaminylglutamylserylalanylprolylphenylalanyl arginylglutaminylalanylalanylleucylarginylhistidylasparaginyl valylalanylprolylisoleucylphenylalanylisoleucylcysteinyl prolylprolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminylisoleucylalanylseryltyrosylglycyl arginylglycyltyrosylthreonyltyrosylleucylleucylserylarginyl alanylglycylvalylthreonylglycylalanylglutamylasparaginyl arginylalanylalanylleucylprolylleucylasparaginylhistidyl leucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginyl alanylalanylprolylprolylleucylglutaminylglycylphenylalanyl glycylisoleucylserylalanylprolylaspartylglutaminylvalyllysyl alanylalanylisoleucylaspartylalanylglycylalanylalanylglycyl alanylisoleucylserylglycylserylalanylisoleucylvalyllysylisol eucylisoleucylglutamylglutaminylhistidylasparaginylisoleucyl glutamylprolylglutamyllysylmethionylleucylalanylalanylleucyl lysylvalylphenylalanylvalylglutaminylprolylmethionyllysyl alanylalanylthreonylarginylserine

It is the name of a protein and no i am not joking this is actually used in a medical journal!
It is 1,913 letters long but technically does not qualify as a word as it is a name.

Apeclemarrystem. its a hawiian plant's root. i love that word.

this word i know how to spell it can''t pronounce it
THE

haha. oh, here's one:
Raghead: a term for a Muslim extremist.